CARACTERIZACIÓN Y PURIFICACIÓN BIOQUIMICA DE UN INHIBIDOR DE SERINOPROTEASA A PARTIR DE SEMILLAS DE Datura stramonium ( Chamico )

Wilmer Julio Paredes Fernández1, Adolfo Ramos Paredes2, George R. Vásquez Bezada2

 

(1)Laboratorio de Bioquímica, Facultad de Ciencias Biológicas, UNSA

(2)Laboratorio de Fisiología Animal Facultad de Ciencias Biológicas, UNSA

DOI:10.26696/sci.epg.0044

RESUMEN: A partir de semillas de Datura stramonium, se ha purificado el inhibidor DasI  de serinoproteasas, a través de cromatografía de exclusión molecular en Sephadex G-75, SP-Sephadex C-50  y cromatografía líquida de alta eficiencia (RP-HPLC).  Y según la electroforesis en gel de poliacrilamida en presencia de dodecil  sulfato de sodio (SDS-PAGE) se determinó la masa molecular del inhibidor  DasI que  fue de 9560.0 Da.

El inhibidor DasI de Datura stramonium inhibe la actividad de la tripsina en una concentración de 25 ug y la ctividad de la quimiotripsina bovina en 60 ug . además, según el análisis de composición de aminoácidos (Sistema PICO-TAG), el inhibidor DasI  posee 22,79 % de aminoácidos de carácter ácido  y 24,04% de carácter hidrofóbico.

La secuencia de los 30 primeros aminoácidos del extremo N-terminal del inhibidor DasI es:

MMKCLVLFVSCLFPIVVFSCSFTSQNPICL, y comparada con otras proteínas de la base de datos SWISS-PROT muestra homología con la familia de las solanáceas.

Finalmente, el inhibidor DasI, mostró efecto antifúngico frente a Aspergillus niger cuando se empleó a una concentración de 5  g/20 ml de caldo de cultivo (caldo Saburaud).

Palabras Clave: Datura stramonium, inhibidor de tripsina; inhibidor de serinoproteasas; homología secuencial.

ABSTRACT: From the seeds of Datura stramonium, the DasI inhibitor of serinoproteases has been purified, by means of exclusion chromatography in Sephadex G-75, SP-Sephadex C-50 and high performance liquid chromatography (RP-HPLC). And according to the polyacrylamide gel electrophoresis in the presence of sodium dodecyl sulfate (SDS-PAGE) the molecular mass of the DasI inhibitor was determined to be 9560.0 Da.

The Datura stramonium DasI inhibitor inhibits trypsin activity at a concentration of 25æg and the activity of bovine chymotrypsin at 60æg. In addition, according to the amino acid composition analysis (PICO-TAG System), the DasI inhibitor possesses 22.79% acidic amino acids and 24.04% hydrophobic character.

The sequence of the first 30 amino acids of the N-terminal end of the DasI inhibitor is: MMKCLVLFVSCLFPIVVFSCSFTSQNPICL, and compared to other proteins in the SWISS-PROT database shows homology with the Solanaceae family.

Finally, the DasI inhibitor showed antifungal effect against Aspergillus niger when used at a concentration of 5 μg / 20 ml culture broth (Saburaud broth).

Keywords: Datura stramonium, trypsin inhibitor; Serine protease inhibitor; Sequential homology.

INTRODUCCIÓN

Las plantas presentan un “arsenal” de defensas contra los ataques de insectos y microorganismos fitopatógenos, entre este arsenal se incluyen los metabolitos secundarios, las defensinas, las lectinas, los inhibidores de serinoproteasas, las proteínas relacionadas a la patogénesis, las tioninas, etc. (Blanco-Labra y Aguirre, 2 002).

Gracias a que las plantas presentan mecanismos bioquímicos de defensa contra plagas y microorganismos fitopatógenos, la búsqueda de productos naturales potencialmente útiles para combatir a estos agentes causantes de grandes pérdidas económicas en los productos agrícolas comercialmente utilizados por el hombre, contribuye a mermar los problemas del uso de insecticidas y fungicidas sintéticos en el combate de plagas y dolencias que, además de ser onerosos para la mayoría de los productores, resultan en contaminación ambiental induciendo el surgimiento de especies resistentes (Xavier-Filho, 1 992).

Dentro del grupo de proteínas de defensa vegetal se encuentran los inhibidores de serinoproteasas (SPI), los cuales actúan sobre las enzimas tripsina, quimiotripsina, elastasa y subtilisina, entre otras. Debido a la gran distribución de estas enzimas en los insectos y microorganismos fitopatógenos, los inhibidores de serinoproteasas presentan un amplio rango de acción (Christeller y Laing, 2 005).

Ya desde 1 947 Kunitz citado por Gueven  et al. (1 998) y Ohba et al. (1 998), Inicia con el estudio de un SPI de semillas de soja, y en los años siguientes las investigaciones han ido creciendo no solo en el campo de control biológico de plagas sino también en el tratamiento del cáncer.

MATERIALES Y MÉTODOS

MATERIAL BIOLÓGICO

Se emplearon semillas de Datura stramonium “Chamico” que fueron recolectadas manualmente en las riveras de la ciudad de Arequipa y de la parte alta de la torrentera de la av. Venezuela.

Reactivos:

Todos los solventes, productos químicos y reactivos químicos

 

 

Correspondencia:

Wilmer Julio Paredes Fernández E-mail: wilmer.aqp@gmail.com

que se utilizarán son de un alto grado de pureza, procedentes de Aldrich (Aldrich Chemical Co, Inc. Wisconsin, U.S.A.), Applied Biosystems (Applied Biosystems - Perkin Elmer

Division, U.S.A.), Bio-Rad (Bio Rad Laboratories - California,

U.S.A.), Merck (Merck - Darmstadt, Germany), Sigma ( Sigma

 

Chemical Co - St. Louis, U.S.A.),.Pierce (Pierce Chemical Company - Illinois, U.S.A). Las enzimas utilizadas para los experimentos son:  Tripsina bovina y porcina (EC 3.4.21.4) y quimotripsina bovina (EC 3.4.21.1), adquiridas de la Sigma.

El substrato sintético, derivado de la p-nitroanilida, es utilizado para el dosaje de tripsina y quimotripsina. Este substrato, peptídeo derivado de la p-nitroanilida, (BAPNA) ha sido ampliamente utilizado, principalmente por la alta sensibilidad, a través de la medida fotométrica en A405 nm de la p-nitroanilida liberada después de la hidrólisis enzimática (Erlanger et al.,, 1961). Los ensayos son realizados con exceso de substrato y el producto de hidrólise (p-nitroanilida) es acompañado por la absorbancia en 405 nm.

La infraestructura, y equipos a utilizar en la presente investigación, fueron compartidos, entre el Instituto de Biología de la Universidad del Estado de Campinas-SP BRASIL y el Laboratorio de Química Biológica de la Facultad de Ciencias Biológicas de la Universidad Nacional de San Agustín – Arequipa.

PURIFICACIÓN DEL INHIBIDOR A PARTIR DE SEMILLAS

DE DATURA STRAMONIUM

Extracción salina (Haldar et al., 1996)

Las semillas enteras fueron trituradas en un molino analítico hasta la obtención de un material pulverizado. La harina de las semillas (70 g) fue homogenizada con solución de NaCl 10% y la suspensión fue mantenida en agitación por 1 hora a temperatura ambiente para la extracción de las proteínas. La suspensión obtenida fue filtrada en gaza y centrifugada a 3000 rpm por 20 minutos a 4°C, siendo el precipitado descartado y el sobrenadante usado como material en las etapas posteriores de purificación del inhibidor.

Precipitación con sulfato de amonio al 90% (Haldar et al., 1996).

Al sobrenadante de la etapa anterior (103 mL) se le adicionó lentamente (agitación constante) sulfato de amonio sólido a saturación del 90% (59,58 g/L) durante una hora, posteriormente se centrifugó a 9000 rpm durante 30 minutos. El precipitado obtenido fue resuspendido en el menor volumen de tampón Tris HCl 0,01 M pH: 7,8, luego la mezcla fue colocada en un saco de diálisis con el mismo tampón por agitación constante; este tampón fue cambiado hasta que la reacción del sulfato de amonio frente al cloruro de bario fue negativa. La muestra obtenida fue enfrentada a la tripsina bovina para ver el efecto inhibitorio.

Cromatografía de gel filtración en Sephadex G-75:

De acuerdo a Tanzima et al., (2001); el sobrenadante claro de la etapa anterior fue colocado en una columna cromatográfica empacada con Sephadex G-75, previamente equilibrada con buffer fosfato 5 mM de pH 7,6. Se colectaron 110 fracciones de 2 ml y en cada una de ellas se midió actividad  y proteína.

Las fracciones que no mostraron actividad se descartaron, mientras que aquellas que si la mostraron fueron liofilizadas y guardadas.

Cromatografía de intercambio iónico en SP-Sephadex C-50 (Antcheva et al., 1996)

A una columna de SP-Sephadex C-50 (1,5 x 5,0 cm.), equilibrada con buffer fosfato 5mM de pH 6,5 (Tanzima et al., 2001), se le colocó el pool formado por las fracciones que mostraron actividad  inhibitoria de la etapa anterior. Una vez que la enzima se ligó a la resina, se eluyó con Cloruro de Sodio (NaCl) 1,5 M.

Las muestras fueron colectadas en un volumen de 4 mL por tubo, en un colector de fracciones (Tipo DE808, Modelo 82197), determinándose la proteína a 540 nm y la actividad enzimática en cada una de ellas a 420 nm.

Las fracciones que exhiben mayor actividad inhibitoria se utilizaron para la obtención del “pool” y fue utilizada para la caracterización bioquímica. Las muestras fueron guardadas a 0o C.

Cromatografía en HPLC de fase reversa (RP-HPLC) 

(Hejgaard et al., 1994)

La fracción con actividad inhibitoria de la etapa anterior fue repurificada en una columna -Bondapack C18 preparativa (0,78 X 30 cm), previamente equilibrada con ácido trifluoracético 0,1% pH: 3,5 (Tampón A) y acoplada a un sistema de HPLC de fase reversa. El sistema cromatográfico usado fue el HPLCPDA 991 (Waters), equipado con dos bombas (Waters) modelo 510/B, y un inyector automático de muestras U6K con un loop de 2 mL de capacidad.

Inicialmente, la elusión de la muestra fue realizada a través de un gradiente lineal con acetonitrilo 66% (Tampón B). La fracción fue monitoriada a 280 nm.

Determinación de proteínas (Método de Biuret) (Hejgaard et al.,  1994)

A 0,1 mL de cada tubo colectado se le añadió 1,0 mL de NaOH 0,5 M y se completó con 4 mL del reactivo de Biuret obteniendo un volumen final de 5 mL. Se incubó a 37ºC por 30 minutos. Se determinó la presencia de proteína por absorbancia a 540 nm

 

en

un

Espectrofotómetro

BIO

RAD

SmartSpec

Plus.

Electroforesis en SDS-PAGE (Laemmli, 1 970)

Las placas de poliacrilamida fueron realizadas de modo discontinuo presentando un gel de carga (stacking gel) de 5 % y un gel de corrida (running gel) de 12,5 %. Las placas fueron preparadas utilizándose una solución de acrilamida stock (30% T, 0,8% C). El gel de carga a 5 % fue preparado utilizándose un tampón Tris-HCl 0,5 M  pH: 6,8 y el gel de corrida utilizándose un tampón Tris-HCl 0,1 M  pH: 8,8. En ambos casos a los geles se les agregó 0,1% de SDS (20%), el cual actúa como agente desnaturalizante.

La electroforesis PAGE-SDS fue realizada en un sistema doble de miniplacas Biometra (Anexo 6). Las muestras y los marcadores de masa molecular fueron disueltos en tampón de muestra (Tris-HCl 0,075 M; pH: 6,8; glicerol 10%; SDS 4% y azul de bromofenol 0,001%). La corrida electroforética fue realizada a 30 mA. Los geles fueron coloreados con solución de Coomassie Blue 0,05% a 37oC, y el exceso de colorante fue removido con ácido acético al 7%.Los patrones de masas moleculares utilizados fueron: fosforilasa B de músculo de conejo (97 kDa), albúmina bovina (66 kDa), ovoalbúmina (45 kDa), anhidrasa carbónica (29 kDa), inhibidor de tripsina de soya (20 kDa) y -lactoalbúmina de leche bovina (14 kDa).

Determinación de la actividad del inhibidor frente a la tripsina bovina (Hejgaard et al., 1 994)

Para determinar la actividad inhibitoria del inhibidor purificado frente a la tripsina bovina (Sigma) se usó el sustrato cromogénico L-BAPNA (Hidrocloruro de p-nitroanilida de Benzoil L-arginina) a 37ºC, midiendo la liberación del producto p-nitroanilida. El medio de reacción tuvo un volumen final de 4,5 mL, conteniendo: 3,5 mL de la solución de sustrato (0,1 mL de LBAPNA disuelto en dimetilsulfoxido y 10 mL de tampón Tris-HCl 0,01 M; CaCl2 0,01 M; NaCl 0,1 M pH: 7.8), diferentes concentraciones del inhibidor y agua destilada. Se inició la reacción con la adición de enzima (250 g/mL); el tiempo de incubación fue de 10 minutos. La reacción se detuvo con la adición de 0,5 mL de ácido acético al 30%.

La p-nitroanilida liberada (aparición del color amarillo) se midió a 420 nm en un Espectrofotómetro BIO RAD SmartSpec Plus contra un blanco.

El medio de ensayo utilizado para medir la actividad inhibitoria en las fracciones obtenidas a partir de las columnas cromatográficas es igual al descrito anteriormente.

Para la determinación de la actividad del inhibidor sobre la actividad enzimática de la serinoproteasa tripsina bovina, se usaron las siguientes concentraciones: 0,0; 3,5; 7,5; 22 y 25 µg. La actividad enzimática se expresó en Unidades (U), que corresponden a los moles de producto liberado por minuto en las condiciones específicas de ensayo. La actividad específica de la enzima es el número de unidades enzimáticas por mg de proteína.

 

Determinación de la actividad del inhibidor frente a  la quimiotripsina  porcina (Hejgaard et al., 1994)

Para un volumen final de 2,0 mL, la mezcla de pre-incubación tuvo 12,5 mL de tampón Tris/HCl 0,01 M, pH: 8,0; 2,1 M de quimiotripsina porcina (Sigma) (disuelta en 1 mL de HCl) y  diferentes concentraciones del inhibidor. La pre-incubación prosiguió durante 10 minutos a 37oC. En seguida se adicionó 0,25 mL del sustrato cromogénico L-BAPNA (Sigma) a la reacción que siguió por 30 minutos; la reacción fue interrumpida por la adición de ácido acético 30% (v/v). La hidrólisis del sustrato por la enzima fue acompañada fotométricamente a 405 nm.

El cálculo de la actividad inhibitoria fue realizado por la determinación de la actividad residual de la quimiotripsina en el ensayo, comparando los resultados obtenidos en ausencia y presencia del inhibidor.

Para determinar la actividad del inhibidor DasI frente a la actividad enzimática de la quimiotripsina porcina, se usaron las siguientes concentraciones: 5; 8; 20; 40 y 60 µg.

Análisis de composición de aminoácidos (Henrikson and Meredith,  1984)

Para la composición de aminoácidos se utilizó un analizador automático de aminoácidos PICO TAG (Sistema Waters), donde la identificación de los aminoácidos fue realizada a través de una cromatografía en HPLC del producto feniltiocarbamil del aminoácido, proveniente de la derivatización con fenilisotiocianato de los aminoácidos obtenidos por hidrólisis ácida. Esta forma de cromóforos puede ser detectada en concentraciones de 1 pmol.

Preparación de la muestra

Solubilización

300 g de la muestra liofilizada fueron disueltos en 50 L de tampón B (acetonitrilo 66% + TFA 0,025%) de HPLC (waters); se centrifugó 200 x g por 15 minutos y se dividió en dos alícuotas de 25 L cada una, posteriormente se secó con ayuda del Work Station (desecador-liofilizador que presenta acoplado un barómetro) hasta 65 militorrs.

Hidrólisis ácida

Posteriormente las muestras (por duplicado) de 25 L cada una fueron colocadas en un frasco de reacción en sus propios tubos; enseguida se colocaron en el fondo del frasco de reacción 100 L de una solución de HCl 6N, además de 1 mg/mL de fenol para evitar la formación de clorotirosina. Enseguida se realizó un vacío de aproximadamente 1-2 torr, hasta el inicio del burbujeo del HCl. Cerrado el vacío, se dejó entrar nitrógeno (SS-ultra puro) por 5 segundos. Esta etapa fue repetida por tres veces. A continuación se removió la tapa del frasco de reacción y la temperatura se elevó a 105oC para la hidrólisis que procederá por 24 horas. Después de este periodo, el tubo de reacción fue colocado en vacío hasta 65 millitorr para secar la muestra hidrolizada.

Derivatización

A la muestra se le adicionó 20 L de una solución de metanol, agua, trietilamina, 2:2:1 (v/v). Cada tubo fue agitado y centrifugado a 250 x g por 15 minutos y colocado en vacío hasta 65 millitorr para su evaporación. Este procedimiento remueve las sales y solventes adsorbidos por los aminoácidos. Una solución fresca de derivatización fue preparada con metanol, trietilamina, agua fenilisotiocianato (PITC), en la proporción 7:1:1:1 (v/v), siendo adicionados 20 L a cada tubo de reacción y se dejó a temperatura ambiente por 30 minutos. Después de la derivatización, la muestra fue secada a vacío hasta 50 militorr, para completar la remoción de todo el PITC. La muestra fue disuelta en 50 L de una solución 0.4 mM de tampón fosfato de sodio conteniendo 5% de acetonitrilo.

El análisis de aminoácidos-PITC fue realizada en HPLC, usando una columna -Bondapack C-18 de fase reversa, con un gradiente lineal de 0 a 100% de acetonitrilo 60% por 21 minutos. La identificación de cada aminoácido fue realizada en relación a una corrida patrón de aminoácidos-PITC. Para la cuantificación de cisteína y metionina, las muestras fueron previamente oxidadas con ácido perfórmico. La hidrólisis y la derivatización de las muestras oxidadas siguen la metodología descrita.

Determinación de la secuencia N-terminal (Marangoni et al., 1999)

Dos miligramos de la proteína purificada, de acuerdo con la metodología anteriormente descrita, fueron disueltos en guanidina 6M conteniendo Tris 0,4 M y EDTA 2 mM con pH final de 8,0, reducida con DTT (14M) y carboximetilada con ácido iodoacético según lo descrito por Marangoni et al., (1999). Después de la reducción y alquilación radioactiva, la muestra fue desalificada por medio de una columna de exclusión molecular en Sephadex G-25, usando el ácido acético 1 M como eluyente. La desalificación se realizó con flujo libre, y se colectaron muestras de 1 ml por tubo. El monitoreo de la corrida se realizó a 280 nm.

La proteína reducida y carboximetilada (RC-Proteína) se sometió a secuenciación directa de la región N-terminal en un secuenciador automático de aminoácidos de la Applied Biosystem modelo 477 A. La identificación de los PTHaminoácido se realizó en un PTH (feniltiohidantoína) Analyzer 120A de la Applied Biosystem.

 

Fig. Nro.3. Cromatografía en HPLC de fase reversa del pico 1 de la etapa anterior en una columna -Bondapack C 18 preparativa (0,78 x 30 cm) equilibrada con TFA 0.1 % (Tampón A), empleando una gradiente lineal de acetonitrilo 50 %. La muestra agregada fue de 5 mg de la fracción 1-1. El monitoreamiento de la corrida se realizó a 280 nm siendo las fracciones colectadas a un flujo constante de 1ml/min.

Electroforesis en SDS-PAGE

La corrida electroforética en gel de poliacrilamida (12,5 %), en presencia de dodecil sulfato de sodio (SDS), de la fracción proteica del inhibidor evidencia que se trata de una proteína de bajo peso molecular: < 14 kDa frente a los marcadores de masa (Gráfico 4). Por otro lado, se puede apreciar la homogeneidad y pureza del inhibidor obtenido al no encontrarse más que una banda bien coloreada en el carril correspondiente al inhibidor.

Mediante el programa Origin 6,0  se obtuvo la figura 5, el cual indica la masa molecular del inhibidor de serinoproteasa a través de una regresión semilogarítmica negativa (Log10 Mm). El valor obtenido corresponde a una masa molecular de ~9,56 kDa la cual está a la mitad del marcador de alfa lactoalbúmina de leche bovina (14 kDa).

 

Fig. Nro.4. Electroforesis en gel de poliacrilamida. Marcadores de masa molecular (Mm): fosforilasa B de músculo de conejo (97kDa), albúmina bovina (66 kDa), Ovoalbumina (45 kDa), Anhidrasa carbónica (29 kDa), Inhibidor de tripsina de soya (20 kDa) y alfa lactoalbúmina de leche bovina (14 kDa).

 

Fig. Nro.5. Determinación de la masa molecular relativa de la fracción mediante el programa Origin 6,0 (~9,56 kDa). Log10 Mm= logaritmo de base 10 de los marcadores de masa molecular en kilodaltons; Rf= distancia migrada de los marcadores entre la distancia total del gel; r= coeficiente de regresión y correlación inversa.

Determinación de la actividad del inhibidor frente a  la tripsina bovina

El porcentaje de inhibición enzimática fue de 71%, 44%, 25%, 15%  y 2% para las concentraciones de 5, 10, 15, 20 y 25  g de inhibidor DasI, respectivamente.

La actividad enzimática se expresó en unidades (U), que corresponden a los moles de producto liberado por minuto en las condiciones específicas de ensayo.

 

Fig. Nro.6. Determinación de la actividad inhibitoria de semillas de Datura stramonium  frente a la tripsina bovina. El cromóforo p-nitroanilida liberado (aparición de color amarillo) fue detectado a 420 nm.

Estudio de homología secuencial de la región N-terminal y construcción del árbol filogenético del inhibidor extraído de semillas de  (Haldar et al., 1996)

La secuencia N-terminal de la fracción obtenida fue comparada, en relación con el grado de homología, con otras secuencias conocidas usando el programa: SWISS-PROT (Annotated protein sequence database), que es un producto de la colaboración entre el instituto suizo de bioinformática y la estación del instituto de bioinformática europeo EMBL. Website: http://www.ncbi.nlm.nih.gov.

Para la construcción del árbol filogenético o filograma se usó el programa ClustalW (DNAStar) que permite obtener las distancias nucleotídicas a partir del alineamiento de las secuencias aminoacídicas ingresadas.

ENSAYO DE LA ACTIVIDAD ANTIFÚNGICA (CÁCERES,

2006)

< >Mantenimiento de Aspergillus nigerLa cepa de Aspergillus niger se colocó en placas de Petri conteniendo agar Sabouraud durante 10 dias a temperatura ambiente.

 

Después de este período, se transfirió los inóculos de este material fúngico (en forma de disco) a una solución salina 0,15 M Para su conservación se guardó el material biológico a 4º C.

< >Extracción de esporas Para la extracción de esporas se empleó 10 mL de solución salina estéril 0,15 M que se vertió sobre el crecimiento micelar. La liberación de esporas se realizó con ayuda de un asa de Drigalski.

 

Las esporas extraídas se recuperaron y cuantificaron en una cámara de Neubauer.

< >Ensayo de inhibición del crecimiento fúngicoLas esporas de Aspergillus niger (4 x 103) se incubaron en 200 L de caldo Sabouraud conteniendo 20 g/mL de inhibidor. El ensayo fue realizado en placas de cultivo celular (96 pozos, Sigma), a temperatura ambiente por un período de 60 horas.

 

La determinación de la densidad óptica (reflejo del crecimiento micelar) fue realizado de 6 en 6 horas en un “lector de ELISA”, a 660 nm. Todo el procedimiento del ensayo fue realizado en condiciones estériles en una cámara de flujo laminar. Los experimentos fueron realizados por triplicado.

RESULTADOS

Cromatografía de exclusión molecular en Sephadex G-75 El sobrenadante proveniente de la extracción salina de 70 g de harina de semillas de  fue purificado a través de una columna cromatográfica en gel de Sephadex G-75,  previamente equilibrada con tampón bicarbonato de amonio 50 mM pH 8,0;  la muestra fue eluida con el mismo tampón.

En el perfil cromatográfico del Figura 1 se observa 4 picos. De todos ellos solo el pico 2 (*) fue el que presentó actividad inhibitoria frente a la tripsina bovina.

 

Fig. Nro.1. Cromatografía de intercambio iónico del extracto salino de semillas de Datura stramonium  sobre Sephadex G75.  La absorbancia de los tubos colectados fue monitoreada a 540 nm

Cromatografía de intercambio iónico en SP-Sephadex C-50 La fracción con actividad inhibitoria, procedente de la etapa anterior, se ligó a una columna de SP-Sephadex C-50 y para la concentración se eluyó con NaCl 1,5 M; como resultado, se obtuvo 1 solo pico de alta actividad inhibitoria, correspondiente a la fracción 2-1

 

Fig. Nro.2. Cromatografía de Intercambio iónico en SPSephadex C-50. El total de la fracción con actividad inhibitoria, fue ligada a una columna de SP-Sephadex C-50, para su concentración. La proteína fue eluida con NaCl 1,5M. Con la fracción 2-1 se formó el pool del inhibidor que sirvió para los estudios posteriores.

Cromatografía en HPLC de fase reversa ( RP-HPLC )

En la Figura 3 se observan dos picos, de los cuales el  pico 1,  fue el único que presentó actividad inhibitoria frente a la tripsina bovina, es decir que correspondería a un inhibidor de serinoproteasa altamente purificado. Este inhibidor purificado fue eluido a los 35  minutos con una concentración de aprox. 50 % del tampón B.

Determinación de la actividad del inhibidor frente a la quimiotripsina porcina

El porcentaje de inhibición enzimática fue de 63%, 36,5%, 21,5%, 6% y 4% para las concentraciones de 5; 8; 20; 40 y 60 g de inhibidor,  respectivamente.

La actividad enzimática se expresó en unidades (U), que corresponden a los moles de producto liberado por minuto en las condiciones específicas de ensayo.

 

Fig. Nro.7. Determinación de la actividad inhibitoria de frente a la quimiotripsina porcina. El cromóforo liberado, pnitroanilida fue detectado a 420 nm.

Análisis de composición de aminoácidos

El inhibidor fue sometido a hidrólisis ácida (HCl 6N) y a derivatización por fenilisotiocianato (PITC) para obtener la composición global de aminoácidos (Tabla 01). El inhibidor DasI muestra una naturaleza ácida, al evidenciar una mayor concentración de aminoácidos ácidos: Asp/10 y Glu/8 en relación a los aminoácidos básicos.  Obteniendose una proteína de carácter acido con un punto isoeléctrico de 4,96.

TABLA Nro.1

Composición de aminoácidos del inhibidor aislado de semillas de Datura stramonium ( DasI )

 

Naturaleza

Aminoácido

Sigla

PM

Residuo (g)

Razón

Molar

MolAA/molP

 

PM

Calculado

Ácido

Asp

D

115,11

10

1151,1

Ácido

Glu

E

129,13

8

1033,04

Polar s/c

Ser

S

87,09

4

348,36

Hidrofóbico

Gly

G

57,07

7

399,49

Básico

His

H

137,10

9

1233,9

Básico

Arg

R

156,21

6

937,26

Polar s/c

Thr

T

101,12

1

101,12

Hidrofóbico

Ala

A

71,09

9

639,81

Hidrofóbico

Pro

P

97,13

2

194,26

Polar s/c

Tyr

Y

163,15

5

815,75

Hidrofóbico

Val

V

99,10

4

396,4

Hidrofóbico

Met

M

131,21

2

262,42

Polar s/c

Cys

C

103,10

4

412,4

Hidrofóbico

Ile

I

103,17

2

206,34

Hidrofóbico

Leu

L

113,17

4

452,68

Hidrofóbico

Phe

F

147,19

4

588,76

Básico

Lys

K

128,19

1

128.19

Polar s/c

Gln

Q

146.00

1

146.0

Polar s/c

Asn

N

132.00

1

132.0

Total

 

 

 

 

9579,28

 

Donde AA/prot: es la razón molar de aminoácido/proteína y PM la: masa molecular

 

< >Determinación del punto Isoelectrico del pico 1-1 DasI

 

< >Predicción de Estructura de la Proteína y sus principales regiones del Pico 1-1

 

Fig. Nro.8. A. Predicción físico-química y análisis de la composición de aminoácidos  de Datura stramonium del pico 1-1, B. Gráfica de la determinación del punto Isoeléctrico (pI) del pico 1-1, que indica que el  pI aproximado es de  4.96, C. Predicción de las principales regiones de la proteína de la fracción 1-1.  Se utilizó el programa DNASTAR.   

Secuencia N-terminal del inhibidor y análisis de homología secuencial

El análisis de la secuencia de los 30 primeros aminoácidos (Nterminales) del inhibidor, obtenido a partir de Datura stramonium reveló el siguiente orden:

MMKCLVLFVSCLFPIVVFSCSFTSQNPICL

La figura mostró que la secuencia N-terminal del inhibidor  presenta homología con las secuencias de la base de datos BLAST (Basic Local Alignment Search Tool) (no putative conserved domains).

TABLA Nro.2

Secuencia N-terminal del inhibidor obtenido a partir de semillas de Datura stramonium

Inhibidor

Secuencia N-terminal

Das-I

MMKCLVLFVSCLFPIVVFSCSFTSQNPICL

 

MMKCLFLLCLCLFPIVVFSSSFTSQNPIEL

 

MMKCLFLLCLCLFPILVFSSTFTSQNPINL

 

MMKCLFFLCLCLFPILVFSSTFTSQNPIDL

 

-MKCLFLLCLCLFPIVVFSSTFTSQNPINL

 

MMKCLFLLCLCLLPIVVFSSTFTSQNLIDL

 

Homología frente a otros tipos de inhibidores de serinoproteasa, consultada en la base de datos:  

 

Fig. Nro.9. Análisis de homología de la secuencia N-terminal

 

Fig.  Nro.10. Árbol filogenético para la secuencia de nucleótidos

http://www.ncbi.nlm.nih.gov/BLAST/Blast.cgi

 

Fig. Nro.11. Cuadro de divergencia y porcentaje de identidad. Utilizando el programa DNASTAR.

Estudio de los efectos biológicos  del DasI

   

A. Efecto de la DasI sobre el crecimiento de Aspergillus niger

De acuerdo a la curva de crecimiento mostrada en el gráfico Nº

12, se puede evidenciar claramente el efecto de la DasI  sobre el crecimiento del Aspergillus niger.  En este experimento se empleó 5 g del  DasI

En la misma se observa que el crecimiento de Aspergillus niger  en ausencia de la lectina es de tipo exponencial, mientras que en presencia de 5 g del inhibidor, la curva de crecimiento comienza a aumentar a partir de 30 horas y luego se muestra un incremento mayor en el crecimiento.

 

Fig. Nro.12. Efecto de la DasI en el crecimiento de Aspergillus niger. La lectura de la absorbancia se realizó a 660 nm para monitorear el crecimiento del hongo. Los experimentos fueron realizados por triplicado.

DISCUSIÓN

El estudio de las proteínas siempre despertará gran interés en el mundo científico donde los investigadores buscan comprender los papeles biológicos que estas moléculas desenpeñan. Dentro de ellas, las de origen vegetal, presentes en semillas ya que recibe la mayor atención debido a su gran uso como fuente alternativa de aminoácidos en la nutrición animal y principalmente en la alimentación de poblaciones menos favorecidas (Montilla, 1994).

La búsqueda de un mayor provecho en la producción de estos alimentos conduce a los investigadores en el estudio de los factores que podrían disminuir el potencial nutricional de estas semillas, ya que están asociados a los mecanismos de defensa de la planta, como en el caso de los inhibidores de proteasas (Ryan, 1990).

Los inhibidores de proteasas son de origen proteico, que se pueden encontrar además en microorganismos y plantas. En los vegetales son ampliamente distribuidos, siendo encontrados en las semillas (Birk, 1994). Dentro del grupo de proteínas de

defensa vegetal se encuentran los inhibidores de serinoproteasas (SPI), los cuales actúan sobre las enzimas tripsina, quimiotripsina, elastasa y subtilisina, entre otras. Debido a la gran distribución de estas enzimas en los insectos y microorganismos fitopatógenos, los inhibidores de serinoproteasas presentan un amplio rango de acción

(Christeller y Laing, 2005).

Ya desde 1947 Kunitz citado por Gueven  et al. (1 998)  y Ohba et al. (1 998), inicia con el estudio de un SPI de semillas de soja, y en los años siguientes las investigaciones han ido creciendo no solo en el campo de control biológico de plagas sino también en el tratamiento del cáncer.

De este modo, en el presente estudio, hemos utilizado tres pasos cromatográficos: cromatografía en gel filtración (Sephadex G-75) y cromatografía de intercambio iónico (Sulfopropil C-50) y finalmente por HPLC en fase reversa. Estos procesos de purificación son bastante empleados en el aislamiento proteínas  vegetales; así, por ejemplo, han sido utilizados para purificar proteínas de Morus sp. (Tanzima et al., 2001), Phaseolus vulgaris L. (Kamemura et al., 1996) y  de Lathyrus sativus (Kolberg y Sletten, 1981). Por esta razón, en el presente trabajo, la cromatografía de gel filtración,  la cromatografía de intercambio iónico y HPLC en fase reversa, nos han permitido obtener un solo pico con actividad inhibitoria a partir del extracto de Datura stramonium.

En el presente estudio se encontró que el  purificado de semillas de Datura stramonium, corresponde a una proteína de carácter ácido (Asp/10 y Glu/8 ) con un peso molecular ~ de 9,56 kDa y capaz de inhibir la actividad de la tripsina bovina (25 µg) y la quimiotripsina porcina (60 µg).

La presencia de aminoácidos ácidos (Asp/10 y Glu/8) en el inhibidor le permite ser soluble en un medio acuoso (Rossmann and Argos, 1981). El inhibidor además de presentar aminoácidos ácidos, presenta aminoácidos que de una u otra forma participan en el modelamiento estructural y funcional del inhibidor.

De todos los aminoácidos, la cisteína (4 residuos) es la única fuerza covalente implicada en el mantenimiento de la estructura proteica. (Rossmann and Argos,  1981).

Entre algunos inhibidores con masa molecular parecida  se encuentran:

(1) El inhibidor de la familia de la “papa” tipo 1 extraído de semillas de Hordeum vulgare “cebada” con una masa molecular de 8,96 kDa y con capacidad de inhibir la subtilisina y quimiotripsina (Greagg et al., 1 994); (2) el inhibidor de la familia de la “papa” tipo 1 extraído de semillas de Sambucus nigra “saúco” con una masa molecular de 8,59 kDa y con capacidad de inhibir la subtilisina y quimiotripsina y responder frente a heridas (Coupe et al., 1 997);  (3) el inhibidor de la familia Bowman Birk extraído de semillas de Dolichos biflorus con una masa molecular de 8,31 kDa y con capacidad de inhibir la tripsina y quimiotripsina (Sreerama and Gowda, 1997); 

(4) el inhibidor de la familia Bowman Birk extraído de semillas de Dolichos axillaris con una masa molecular de 8,29 kDa y con capacidad de inhibir la tripsina y quimiotripsina (Joubert et al., 1 979) y   (5) el inhibidor de la familia de la “papa” tipo 1 extraído del tubérculo de Solanum tuberosum “papa” con una masa molecular de 8,03 kDa y con capacidad de inhibir la tripsina y quimiotripsina (Richardson and Cossins, 1 974).

Respecto a la actividad inhibitoria de  DasI  frente a la tripsina bovina, Stryer et al. (2002),  informan que el inhibidor pancreático de la tripsina humana, una proteína de 6 kDa, inhibe la tripsina porque se une con gran fuerza a su sitio activo.   La razón de esta estabilidad excepcional del complejo EI es que el inhibidor pancreático de la tripsina es un análogo del sustrato enormemente efectivo. Los análisis con rayos X demuestran que los inhibidores  se sitúan  en el sitio activo de la enzima, posicionado de tal forma que la cadena lateral de la lisina 15 del inhibidor interacciona con la cadena lateral del aspartato 189 de la tripsina.   Más aún el grupo carbonilo de la lisina 15 y los átomos del inhibidor que lo rodean encajan cómodamente en el sitio activo de la enzima. La comparación entre la estructura del inhibidor unido a la enzima y la del inhibidor libre revela que su estructura permanece esencialmente inalterada al unirse a la enzima.

Un inhibidor de serinoproteasa presenta un asa (loop) que se mimetiza con la estructura del sustrato, y gracias a ello interacciona y permanece estable en el sitio activo de la enzima. El asa presenta una cadena lateral de aminoácidos que se mimetiza con los aminoácidos del sustrato. Estas características producen una interacción rápida  y una lenta liberación del inhibidor (Christeller, 2005). 

Según la alta capacidad inhibitoria (25 µg) de  frente a la tripsina bovina es probable la presencia del aminoácido lisina en su estructura o la presencia de otros aminoácidos que forman parte del asa del inhibidor. Mediante los análisis de rayos X o resonancia magnética nuclear (NMR) se puede dilucidar los aminoácidos que participan realmente en la interacción enzima/inhibidor.

Consecuentemente,  la actividad inhibitoria del inhibidor  frente a la quimiotripsina porcina, Christeller and Laing (2005) reportan que el inhibidor de la familia Kunitz de la quimiotripsina, presenta un asa con aminoácidos hidrofóbicos (fenilalanina o triptófano) que le permite incrementar su afinidad para con la enzima. El asa del inhibidor también puede presentar leucina y fenilalanina para la formación del complejo enzima/inhibidor.     El Inhibidor  presenta actividad inhibitoria frente a la quimiotripsina porcina, pero se requieren altas concentraciones (60 µg) para alcanzar este efecto. Probablemente, el inhibidor presente pocos  aminoácidos hidrofóbicos, leucina y fenilalanina en su estructura. Para verificar la presencia de los aminoácidos que participan en la interacción enzima/inhibidor  se requiere de los análisis de cristalografía de rayos X o NMR.

La inhibición competitiva se caracteriza porque el inhibidor compite con el sustrato por el sitio activo de la enzima. Mientras que la inhibición no competitiva se caracteriza porque el inhibidor interacciona con los sitios alostéricos de la enzima o bien con el complejo enzima - sustrato, que ya no formará producto.

El análisis completo de aminoácidos reveló que  DAsI es un inhibidor de naturaleza Acida e Hidrofóbica  constituida por aminoácidos acidos  al 22,79 %, los básicos 11,12 %, los neutros 20,04 % y los hidrofóbicos 24,05 % el aminoácido presente en mayor cantidad corresponde a el acido aspartico  (Asp) (12,01%), mientras que la menor le pertenece a la  Asparagina (Asn) cada una con 1,19 %. Y aplicandole el análisis del programa DNASTAR se pudo determinar la predicción estructural, su pI que fue de 4,96  y finalmente la predicción de las principales regiones de la proteína del pico 1-1 del DasI. El inhibidor  presenta una mayor especificidad para la tripsina bovina,  posiblemente por la alta concentración de Arginina o Histidina en su sitio reactivo.

Para el caso inhibitorio de la tripsina porcina, es probable que exista una baja concentración de estos aminoácidos en el sitio reactivo del inhibidor (Christeller and Laing, 2005).   Si no hay efecto inhibitorio  frente a la quimiotripsina bovina  es probable que el inhibidor no presente fenilalanina, triptófano, leucina o alanina en su sitio reactivo (Christeller and Laing, 2 005).

Analizando,  la secuencia N-terminal se halló que el inhibidor presenta un 82% de homología aminoacídica con el inhibidor de tripsina extraído de la solanácea , Solanum lycopersicum (CAC00536) y un 75 % de homología con el inhibidor de  Solanum tuberosum. Según los autores, el inhibidor de tripsina de Solanum lycopersicum   inhibe la actividad de la tripsina, quimiotripsina, plasmina, kalikreina plasmática y el factor XIIa de la cascada de coagulación. Debido a que el  DasI se encuentra emparentada con el inhibidor de tripsina de Solanum lycopersicum, tal vez podría participar de algunas propiedades correspondientes a inhibidores representantes de la familia Kunitz. La familia de inhibidores Kunitz es la primera familia descrita en Leguminosas, pero también se distribuye en Gramíneas, Aráceas, Alismatáceas, Arabidopsis thaliana y Solanáceas (Laskowski and Kato, 1980). Presentan un masa molecular entre 9 y 22 kDa, y aproximadamente 181 residuos de aminoácidos, incluyendo  cuatro residuos de cisteína que forman dos puentes disulfuro que estabilizan su estructura (Richardson, 1991).

Otras de las proteínas que presentan similitud con el inhibidor  fueron las siguientes: el inhibidor de Solanum tuberosum (75 % de homología) (Q41448); el precursor  del inhibidor  de tripsina de la familia Kunitz-(cadena α) extraído de semillas de  Solanum tuberosum (72% de homología) (AAL99260)

(Negreiros et al.,  1991); el inhibidor de serinoproteasa extraído de semillas de Solanum tuberosum  (77 % de homología) (AAO23566) (Richardson et al., 1986); y el precursor del inhibidor de tipo Kunitz-type extraido de Solanum tuberosum  (71 % de homología) (AAZ94184) (Caldwell et al., 1990).

Con respecto a la familia solanácea,  a la cual pertenece Datura stramonium , no se tienen referencias respecto a la presencia de inhibidores de serinoproteasas, por tal motivo algunas otras características que pueda tener el  se deduce por homología secuencial.

Según el árbol filogenético creado mediante el software DNAStar se halló que el inhibidor DasI  posee una aproximación micro-evolutiva de ~ 1 000 nucleótidos con el inhibidor de tripsina extraído de la solanácea, Solanum lycopersicum (CAC00536). La distancia micro-evolutiva con las otras proteínas (AAO23566, AAZ94184, AAL99260) es mucho mayor a los 1 000 nucleótidos. Mediante este análisis vemos que  DasI  se encuentra emparentado filogenéticamente con la familia de las solanáceas, Solanum lycopersicum y Solanum tuberosum. La diferencia micro-evolutiva podría variar en función de la secuencia total, pues tan sólo esta aproximación se da a partir de la secuencia N-terminal (30 aminoácidos).

El hecho de que el inhibidor DasI (Inhibidor de Datura stramonium)  inhibe el crecimiento de los hongos Aspergillus niger  (Figura 12 y 13),  probablemente se debe a que los inhibidores de tripsina y quimotripsina bloquean la síntesis de quitina de la pared celular del hongo, lo cual causa la destrucción de la hifa fungal  (Lorito et al., 1994).  En apoyo a esta hipótesis se ha reportado que la tripsina endógena regula a la quitina sintasa, convirtiendo el precursor zimógeno en una forma activa. Probablemente, este mismo mecanismo ocurra en la inhibición del crecimiento del  hongo  Aspergillus niger, sometido  al inhibidor  DasI. 

Además, se debe indicar que el inhibidor  tiene un efecto intenso sobre  Aspergillus niger  ya que se puede observar que a las 40 horas el hongo comienza a desarrollar un crecimiento continuo y exponencial, mientras que con el inhibidor se observa que a las 40 y 50 horas muestran un crecimiento muy lento  (Figura 12 y 13).

Por otra parte, se ha encontrado que  Aspergillus niger  secreta enzimas similares a subtilisina (serinoproteasa), que le permiten invadir el tejido del huésped y aprovechar las proteínas del medio de cultivo (Valueva and Mosolov, 2004). Además, se ha encontado que el inhibidor de tripsina de papa reduce la actividad de proteasas exógenas halladas en cultivos de hongos (Mosolov et al., 1976). Por lo tanto, se puede inferir, que el hongo  Aspergillus niger, al secretar enzimas proteolíticas en el medio de cultivo que contiene el inhibidor, tengan problemas en su crecimiento, debido a la presencia de un mecanismo de unión entre el inhibidor y las enzimas secretadas, y como consecuencia de esta inhibición el hongo ingresaría en un estado de desnutrición que impide su crecimiento normal.

Por lo discutido anteriormente, podemos deducir que el inhibidor DasI  de las semillas de  Datura stramonium,  es una proteína biológicamente importante que puede ser usada como herramienta molecular para estudiar el mecanismo catalítico de las enzimas digestivas, por ejemplo de la calicreína plasmática, además de la aplicación clínica en un futuro próximo (Nakagaki et al., 1996).

Finalmente, de acuerdo con el análisis del efecto inhibitorio frente a  Aspergillus niger,  podemos sugerir que el inhibidor DasI, después de más estudios, se podría convertir en una herramienta biotecnológica con la finalidad de mejorar el mecanismo de defensa vegetal contra el ataque de patógenos usando la ingeniería genética (cDNA)  y además   hay un tremendo interés en el posible uso de los inhibidores de origen vegetal que podrían actuar sobre las proteasas en el tratamiento de transtornos metabó



Publicación Actual
Volumen 3 - Número 1 (2017)

Desarrollado por: www.businessonline.pe