CARACTERIZACIÓN Y PURIFICACIÓN BIOQUIMICA DE UN INHIBIDOR DE SERINOPROTEASA A PARTIR DE SEMILLAS DE Datura stramonium ( Chamico )

Wilmer Julio Paredes Fernández1, Adolfo Ramos Paredes2, George R. Vásquez Bezada2

(1)Laboratorio de Bioquímica, Facultad de Ciencias Biológicas, UNSA

(2)Laboratorio de Fisiología Animal Facultad de Ciencias Biológicas, UNSA

RESUMEN: A partir de semillas de Datura stramonium, se ha purificado el inhibidor DasI  de serinoproteasas, a través de cromatografía de exclusión molecular en Sephadex G-75, SP-Sephadex C-50  y cromatografía líquida de alta eficiencia (RP-HPLC).  Y según la electroforesis en gel de poliacrilamida en presencia de dodecil  sulfato de sodio (SDS-PAGE) se determinó la masa molecular del inhibidor  DasI que  fue de 9560.0 Da.

El inhibidor DasI de Datura stramonium inhibe la actividad de la tripsina en una concentración de 25 ug y la ctividad de la quimiotripsina bovina en 60 ug . además, según el análisis de composición de aminoácidos (Sistema PICO-TAG), el inhibidor DasI  posee 22,79 % de aminoácidos de carácter ácido  y 24,04% de carácter hidrofóbico.

La secuencia de los 30 primeros aminoácidos del extremo N-terminal del inhibidor DasI es:

MMKCLVLFVSCLFPIVVFSCSFTSQNPICL, y comparada con otras proteínas de la base de datos SWISS-PROT muestra homología con la familia de las solanáceas.

Finalmente, el inhibidor DasI, mostró efecto antifúngico frente a Aspergillus niger cuando se empleó a una concentración de 5  g/20 ml de caldo de cultivo (caldo Saburaud).

Palabras Clave: Datura stramonium, inhibidor de tripsina; inhibidor de serinoproteasas; homología secuencial.

ABSTRACT: From the seeds of Datura stramonium, the DasI inhibitor of serinoproteases has been purified, by means of exclusion chromatography in Sephadex G-75, SP-Sephadex C-50 and high performance liquid chromatography (RP-HPLC). And according to the polyacrylamide gel electrophoresis in the presence of sodium dodecyl sulfate (SDS-PAGE) the molecular mass of the DasI inhibitor was determined to be 9560.0 Da.

The Datura stramonium DasI inhibitor inhibits trypsin activity at a concentration of 25æg and the activity of bovine chymotrypsin at 60æg. In addition, according to the amino acid composition analysis (PICO-TAG System), the DasI inhibitor possesses 22.79% acidic amino acids and 24.04% hydrophobic character.

The sequence of the first 30 amino acids of the N-terminal end of the DasI inhibitor is: MMKCLVLFVSCLFPIVVFSCSFTSQNPICL, and compared to other proteins in the SWISS-PROT database shows homology with the Solanaceae family.

Finally, the DasI inhibitor showed antifungal effect against Aspergillus niger when used at a concentration of 5 μg / 20 ml culture broth (Saburaud broth).

Keywords: Datura stramonium, trypsin inhibitor; Serine protease inhibitor; Sequential homology



Publicación Actual
Volumen 11 - Número 1 (2025)